Web stats for Thefreepdfreader - thefreepdfreader.com
Download PDF Software free from thefreepdfreader. Safe, recommended, editor-reviewed software files for your PC computer.
1.82 Rating by ClearWebStats
thefreepdfreader.com is 1 decade 8 months 3 weeks old. This website has a #2,889,420 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, thefreepdfreader.com is SAFE to browse.
Traffic Report of Thefreepdfreader
Daily Unique Visitors: | 167 |
Daily Pageviews: | 334 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 3 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 2,889,420 |
Domain Authority: | 9 ON 100 |
Google Pagerank
PR 0 out of 10
PageSpeed Score
83
Siteadvisor Rating
No Risk Issues
Where is thefreepdfreader.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 2 |
Google Adsense: | Not Applicable | Google Analytics: | UA-43309860-1 |
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 15 May 2014 04:21:23 GMT
Server: Apache/2.2.24 (Unix) mod_ssl/2.2.24 OpenSSL/1.0.0-fips mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
X-Powered-By: PHP/5.3.26
X-Pingback: http://thefreepdfreader.com/xmlrpc.php
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Thu, 15 May 2014 04:21:23 GMT
Server: Apache/2.2.24 (Unix) mod_ssl/2.2.24 OpenSSL/1.0.0-fips mod_auth_passthrough/2.1 mod_bwlimited/1.4 FrontPage/5.0.2.2635
X-Powered-By: PHP/5.3.26
X-Pingback: http://thefreepdfreader.com/xmlrpc.php
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information for thefreepdfreader.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
thefreepdfreader.com | A | 3595 |
IP:64.91.254.49 |
thefreepdfreader.com | NS | 3600 |
Target:ns1.liquidweb.com |
thefreepdfreader.com | NS | 3600 |
Target:ns.liquidweb.com |
thefreepdfreader.com | SOA | 3600 |
MNAME:ns.liquidweb.com RNAME:admin.liquidweb.com Serial:2013082001 Refresh:86400 Retry:7200 Expire:3600000 |
thefreepdfreader.com | MX | 3600 |
Priority:10 Target:thefreepdfreader.com |
Similarly Ranked Websites to Thefreepdfreader
99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business
- 99jeeveswaydigitalmarketingservices.com
Plastic Surgery Utah - The Best Cosmetic Surgeon In Salt Lake City
- surface-med.com
Utah plastic Surgeons Dr. Barson and staff provide Utah with plastic surgery options for residents throughout Utah & Salt Lake City. Discover the best
My Humble Kitchen - Where Simple, Economical Cooking Brings Joy, Comfort, and Nourishment to the Family Table
- spain-in-iowa.com